PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_026070_crae.t1
Common NameSOVF_026070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family GATA
Protein Properties Length: 510aa    MW: 57535.9 Da    PI: 8.8004
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_026070_crae.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA51.41.5e-16211244134
               GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                        C +C tt+Tp+WR gp g  tLCnaCG+ y+  +
  Sp_026070_crae.t1 211 CMHCETTDTPQWRTGPLGRGTLCNACGVQYKQGR 244
                        99*****************************987 PP

2GATA50.92.1e-16431464134
               GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                        C +C +t+Tp+WR+gp g ktLCnaCG+ y+  +
  Sp_026070_crae.t1 431 CLHCESTETPQWREGPMGRKTLCNACGVQYKAGR 464
                        99****************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.7E-14205259IPR000679Zinc finger, GATA-type
SuperFamilySSF577167.13E-13209263No hitNo description
PROSITE profilePS5011411.464209241IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.6E-13210243IPR013088Zinc finger, NHR/GATA-type
CDDcd002027.71E-12210259No hitNo description
PROSITE patternPS003440211236IPR000679Zinc finger, GATA-type
PfamPF003204.2E-14211244IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.104.2E-14424463IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577165.23E-13424482No hitNo description
SMARTSM004011.5E-14425475IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.11425461IPR000679Zinc finger, GATA-type
CDDcd002024.61E-12430479No hitNo description
PROSITE patternPS003440431456IPR000679Zinc finger, GATA-type
PfamPF003207.3E-14431464IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 510 aa     Download sequence    Send to blast
MAASGKKVLA MSGNGENGDD PISNTHFSFG QLLDLGVINQ YGQLLGEYSR LDEELWLSEP  60
EPDDVVDNLD RSDDGVNHFA TSPSEFVDKT VCDGGMATVK EKLTSLKDCS QNLSSPISVF  120
QTKSSYSDDI TTICSQSKCL PPTKHKFSGS LQFLGTTMST REQRCGLQSE SEYSMESLSD  180
ENEESIPSKS VRTRKISDLL DLDYDPAIKK CMHCETTDTP QWRTGPLGRG TLCNACGVQY  240
KQGRLFSVYR PLRSPAFDPS LHSNLPKKVH EMRKGSSNEG DPNPPTPKPK KKKVEEMRMS  300
NKSERDPSPT PKPKKVVPTP ELKKVEEMRM GNYSEMARNL SFEQRKAEEM KKGNNSDMAR  360
DLSFEQRKAD EMILGNENER YQNRAHRAKK FEEMREKASN VVQSDSRKRN REFDSYPTVK  420
RKLARKVAKK CLHCESTETP QWREGPMGRK TLCNACGVQY KAGRLFPEYR PLKSPTYNPS  480
LHSHLPKKVL KMRMSSSENC ATSGNHEKPA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010681549.11e-167PREDICTED: uncharacterized protein LOC104896501
TrEMBLA0A0K9RV050.0A0A0K9RV05_SPIOL; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.28e-27GATA family protein